Lineage for d3b3va_ (3b3v A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1860688Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1861985Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 1862178Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)
  6. 1862189Protein Aminopeptidase [53205] (2 species)
  7. 1862190Species Aeromonas proteolytica [TaxId:671] [53206] (17 PDB entries)
    Uniprot Q01693
    synonym: Vibrio proteolyticus
  8. 1862196Domain d3b3va_: 3b3v A: [172420]
    automated match to d1ampa_
    complexed with na, scn, val, zn; mutant

Details for d3b3va_

PDB Entry: 3b3v (more details), 1.22 Å

PDB Description: crystal structure of the s228a mutant of the aminopeptidase from vibrio proteolyticus
PDB Compounds: (A:) Bacterial leucyl aminopeptidase

SCOPe Domain Sequences for d3b3va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b3va_ c.56.5.4 (A:) Aminopeptidase {Aeromonas proteolytica [TaxId: 671]}
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacadhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg

SCOPe Domain Coordinates for d3b3va_:

Click to download the PDB-style file with coordinates for d3b3va_.
(The format of our PDB-style files is described here.)

Timeline for d3b3va_: