SCOPe 2.03: Domain d3b3ca_: 3b3c A:

Lineage for d3b3ca_ (3b3c A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)

6. Protein Aminopeptidase [53205] (2 species)

7. Species Aeromonas proteolytica [TaxId:671] [53206] (17 PDB entries)
   Uniprot Q01693
   synonym: Vibrio proteolyticus

8. Domain d3b3ca_: 3b3c A: [172411]
   automated match to d1ampa_
   complexed with k, na, plu, scn, zn; mutant

Details for d3b3ca_

PDB Entry: 3b3c, 1.46 Å

PDB Description: crystal structure of the m180a mutant of the aminopeptidase from vibrio proteolyticus in complex with leucine phosphonic acid

PDB Compounds: (A:) Bacterial leucyl aminopeptidase

SCOPe Domain Sequences for d3b3ca_:

Sequence; same for both SEQRES and ATOM records:

>d3b3ca_ c.56.5.4 (A:) Aminopeptidase {Aeromonas proteolytica [TaxId: 671]}
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqlda
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg

Timeline for d3b3ca_:

• d3b3ca_ first appeared in SCOPe 2.01
  
• d3b3ca_ appears in SCOPe 2.02
  
• d3b3ca_ appears in SCOPe 2.04
  
• d3b3ca_ appears in the current release, SCOPe 2.08