SCOPe 2.03: Domain d3ayzb_: 3ayz B:

Lineage for d3ayzb_ (3ayz B:)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.0: automated matches [191636] (1 protein)
   not a true family

6. Protein automated matches [191172] (2 species)
   not a true protein

7. Species Hydrogenovibrio marinus [TaxId:28885] [189746] (3 PDB entries)

8. Domain d3ayzb_: 3ayz B: [172388]
   Other proteins in same PDB: d3ayza_, d3ayzc_
   automated match to d1yq9a1
   complexed with 3ni, cmo, cyn, f3s, f4s, fe2, gol, mg, o, sf3, sf4

Details for d3ayzb_

PDB Entry: 3ayz, 1.22 Å

PDB Description: Membrane-bound respiratory [NiFe] hydrogenase from Hydrogenovibrio marinus in an air-oxidized condition

PDB Compounds: (B:) Membrane-bound hydrogenase small subunit

SCOPe Domain Sequences for d3ayzb_:

Sequence; same for both SEQRES and ATOM records:

>d3ayzb_ e.19.1.0 (B:) automated matches {Hydrogenovibrio marinus [TaxId: 28885]}
prtpviwlhglectccsesfirsahplakdvvlsmisldyddtlmaasghaaeaildeik
ekykgnyilavegnpplnqdgmsciiggrpfseqlkrmaddakaiiswgscaswgcvqaa
kpnptqatpvhkflgggydkpiikvpgcppiaevmtgvitymltfdripeldrqgrpkmf
ysqrihdkcyrrphfdagqfveewddegarkgyclykvgckgpttynacstvrwnggtsf
piqsghgcigcsedgfwdkgsfysrdtemnafg

Timeline for d3ayzb_:

• d3ayzb_ first appeared in SCOPe 2.01
  
• d3ayzb_ appears in SCOPe 2.02
  
• d3ayzb_ appears in SCOPe 2.04
  
• d3ayzb_ appears in the current release, SCOPe 2.08