SCOPe 2.01: Domain d3ayyb_: 3ayy B:

Lineage for d3ayyb_ (3ayy B:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.0: automated matches [191636] (1 protein)
   not a true family

6. Protein automated matches [191172] (2 species)
   not a true protein

7. Species Hydrogenovibrio marinus [TaxId:28885] [189746] (3 PDB entries)

8. Domain d3ayyb_: 3ayy B: [172386]
   automated match to d1yq9a1
   complexed with 3ni, cmo, cyn, f3s, fe2, gol, mg, o, sf3, sf4

Details for d3ayyb_

PDB Entry: 3ayy, 1.32 Å

PDB Description: membrane-bound respiratory [nife] hydrogenase from hydrogenovibrio marinus in a ferricyanide-oxidized condition

PDB Compounds: (B:) Membrane-bound hydrogenase small subunit

SCOPe Domain Sequences for d3ayyb_:

Sequence; same for both SEQRES and ATOM records:

>d3ayyb_ e.19.1.0 (B:) automated matches {Hydrogenovibrio marinus [TaxId: 28885]}
prtpviwlhglectccsesfirsahplakdvvlsmisldyddtlmaasghaaeaildeik
ekykgnyilavegnpplnqdgmsciiggrpfseqlkrmaddakaiiswgscaswgcvqaa
kpnptqatpvhkflgggydkpiikvpgcppiaevmtgvitymltfdripeldrqgrpkmf
ysqrihdkcyrrphfdagqfveewddegarkgyclykvgckgpttynacstvrwnggtsf
piqsghgcigcsedgfwdkgsfysrdtemnafg

Timeline for d3ayyb_:

• d3ayyb_ is new in SCOPe 2.01-stable
  
• d3ayyb_ appears in SCOPe 2.02
  
• d3ayyb_ last appears in SCOPe 2.06