Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.7: 14-3-3 protein [48445] (1 family) automatically mapped to Pfam PF00244 |
Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) |
Protein automated matches [190238] (9 species) not a true protein |
Species Oryza sativa [TaxId:39947] [189745] (1 PDB entry) |
Domain d3axyj_: 3axy J: [172376] automated match to d1o9ca_ protein/DNA complex |
PDB Entry: 3axy (more details), 2.4 Å
SCOPe Domain Sequences for d3axyj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3axyj_ a.118.7.1 (J:) automated matches {Oryza sativa [TaxId: 39947]} sreenvymaklaeqaeryeemveymekvaktvdveeltveernllsvayknvigarrasw rivssieqkeegrgneehvtlikeyrgkieaelskicdgilklldshlvpsstaaeskvf ylkmkgdyhrylaefktgaerkeaaestmvaykaaqdialadlapthpirlglalnfsvf yyeilnspdkacnlakqafdeaiseldtlgeesykdstlimqllrdnltlwtsd
Timeline for d3axyj_: