SCOPe 2.01: Domain d3axyc_: 3axy C:

Lineage for d3axyc_ (3axy C:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein automated matches [190238] (4 species)
   not a true protein

7. Species Oryza sativa [TaxId:39947] [189745] (1 PDB entry)

8. Domain d3axyc_: 3axy C: [172373]
   automated match to d1o9ca_
   protein/DNA complex

Details for d3axyc_

PDB Entry: 3axy, 2.4 Å

PDB Description: Structure of Florigen Activation Complex Consisting of Rice Florigen Hd3a, 14-3-3 Protein GF14 and Rice FD Homolog OsFD1

PDB Compounds: (C:) 14-3-3-like protein GF14-C

SCOPe Domain Sequences for d3axyc_:

Sequence; same for both SEQRES and ATOM records:

>d3axyc_ a.118.7.1 (C:) automated matches {Oryza sativa [TaxId: 39947]}
msreenvymaklaeqaeryeemveymekvaktvdveeltveernllsvayknvigarras
wrivssieqkeegrgneehvtlikeyrgkieaelskicdgilklldshlvpsstaaeskv
fylkmkgdyhrylaefktgaerkeaaestmvaykaaqdialadlapthpirlglalnfsv
fyyeilnspdkacnlakqafdeaiseldtlgeesykdstlimqllrdnltlwtsd

Timeline for d3axyc_:

• d3axyc_ is new in SCOPe 2.01-stable
  
• d3axyc_ appears in SCOPe 2.02
  
• d3axyc_ appears in the current release, SCOPe 2.08