Lineage for d3avpa_ (3avp A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1366119Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1366120Protein automated matches [190123] (58 species)
    not a true protein
  7. 1366436Species Mycobacterium tuberculosis [TaxId:1773] [189039] (12 PDB entries)
  8. 1366442Domain d3avpa_: 3avp A: [172357]
    automated match to d1esma_
    complexed with flc, gol, mv2, na

Details for d3avpa_

PDB Entry: 3avp (more details), 2.6 Å

PDB Description: Pantothenate kinase from Mycobacterium tuberculosis (MtPanK) in complex with Pantothenol
PDB Compounds: (A:) pantothenate kinase

SCOPe Domain Sequences for d3avpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3avpa_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
epspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqva
arqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdl
vttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydii
pgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrtt
afadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsin
rlrlrkl

SCOPe Domain Coordinates for d3avpa_:

Click to download the PDB-style file with coordinates for d3avpa_.
(The format of our PDB-style files is described here.)

Timeline for d3avpa_: