SCOPe 2.01: Domain d3avea1: 3ave A:234-339

Lineage for d3avea1 (3ave A:234-339)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (28 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d3avea1: 3ave A:234-339 [172352]
   Other proteins in same PDB: d3avea2, d3aveb2
   automatically matched to d1hzhh3
   complexed with zn

Details for d3avea1

PDB Entry: 3ave, 2 Å

PDB Description: crystal structure of the fucosylated fc fragment from human immunoglobulin g1

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d3avea1:

Sequence; same for both SEQRES and ATOM records:

>d3avea1 b.1.1.2 (A:234-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
llggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpre
eqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Timeline for d3avea1:

• d3avea1 is new in SCOPe 2.01-stable
  
• d3avea1 appears in SCOPe 2.02
  
• d3avea1 appears in the current release, SCOPe 2.08