SCOPe 2.01: Domain d3at5a_: 3at5 A:

Lineage for d3at5a_ (3at5 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (30 species)
   not a true protein

7. Species Podocnemis unifilis [TaxId:227871] [189922] (2 PDB entries)

8. Domain d3at5a_: 3at5 A: [172328]
   automated match to d1fawa_
   protein/DNA complex; complexed with hem

Details for d3at5a_

PDB Entry: 3at5, 2.2 Å

PDB Description: Side-necked turtle (Pleurodira, Chelonia, REPTILIA) hemoglobin: cDNA-derived primary structures and X-ray crystal structures of Hb A

PDB Compounds: (A:) AlphaA-globin

SCOPe Domain Sequences for d3at5a_:

Sequence; same for both SEQRES and ATOM records:

>d3at5a_ a.1.1.2 (A:) automated matches {Podocnemis unifilis [TaxId: 227871]}
vlspgdkanvktvwskvsghvedygaetlerlfrvypstktyfphfdlhhdsaqirthgk
kvltaigeavshiddiasalsklsdlhaqtlrvdpvnfkllshsflvvlavhapslltpe
vhvsldkflvavsnvltskyr

Timeline for d3at5a_:

• d3at5a_ is new in SCOPe 2.01-stable
  
• d3at5a_ appears in SCOPe 2.02
  
• d3at5a_ appears in the current release, SCOPe 2.08