Lineage for d3arco_ (3arc O:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1236764Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 1236765Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 1236796Family f.4.1.4: PsbO-like [161115] (2 proteins)
    Pfam PF01716; MSP
  6. 1236797Protein Manganese-stabilising protein, PsbO [161116] (2 species)
  7. 1236800Species Thermosynechococcus vulcanus [TaxId:32053] [189919] (2 PDB entries)
  8. 1236801Domain d3arco_: 3arc O: [172318]
    Other proteins in same PDB: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arch_, d3arcj_, d3arck_, d3arcl_, d3arcm_, d3arcu_, d3arcv_, d3arcz_
    automated match to d2axto1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d3arco_

PDB Entry: 3arc (more details), 1.9 Å

PDB Description: Crystal structure of oxygen-evolving Photosystem II at 1.9 angstrom resolution
PDB Compounds: (O:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d3arco_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arco_ f.4.1.4 (O:) Manganese-stabilising protein, PsbO {Thermosynechococcus vulcanus [TaxId: 32053]}
tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea
efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk
nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela
ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi
epa

SCOPe Domain Coordinates for d3arco_:

Click to download the PDB-style file with coordinates for d3arco_.
(The format of our PDB-style files is described here.)

Timeline for d3arco_: