Lineage for d3arcm_ (3arc M:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456646Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1457574Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) (S)
    automatically mapped to Pfam PF05151
  5. 1457575Family f.23.35.1: PsbM-like [161034] (2 proteins)
    Pfam PF05151
  6. 1457576Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)
  7. 1457581Species Thermosynechococcus vulcanus [TaxId:32053] [189918] (1 PDB entry)
  8. 1457582Domain d3arcm_: 3arc M: [172317]
    Other proteins in same PDB: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arch_, d3arci_, d3arcj_, d3arck_, d3arcl_, d3arco_, d3arct_, d3arcu_, d3arcv_, d3arcz_
    automated match to d2axtm1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d3arcm_

PDB Entry: 3arc (more details), 1.9 Å

PDB Description: Crystal structure of oxygen-evolving Photosystem II at 1.9 angstrom resolution
PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d3arcm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arcm_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus vulcanus [TaxId: 32053]}
mevnqlgliatalfvlvpsvfliilyvqtesqqk

SCOPe Domain Coordinates for d3arcm_:

Click to download the PDB-style file with coordinates for d3arcm_.
(The format of our PDB-style files is described here.)

Timeline for d3arcm_: