Lineage for d3arcl_ (3arc L:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1060159Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
  5. 1060160Family f.23.31.1: PsbL-like [161018] (2 proteins)
    Pfam PF02419
  6. 1060164Protein automated matches [191003] (2 species)
    not a true protein
  7. 1060168Species Thermosynechococcus vulcanus [TaxId:32053] [189917] (1 PDB entry)
  8. 1060169Domain d3arcl_: 3arc L: [172316]
    Other proteins in same PDB: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arch_, d3arcj_, d3arcm_, d3arco_, d3arcu_, d3arcv_
    automated match to d2axtl1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d3arcl_

PDB Entry: 3arc (more details), 1.9 Å

PDB Description: Crystal structure of oxygen-evolving Photosystem II at 1.9 angstrom resolution
PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d3arcl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arcl_ f.23.31.1 (L:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d3arcl_:

Click to download the PDB-style file with coordinates for d3arcl_.
(The format of our PDB-style files is described here.)

Timeline for d3arcl_: