Lineage for d3apgb1 (3apg B:2-471)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2831434Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins)
  6. 2831606Protein automated matches [190245] (12 species)
    not a true protein
  7. 2831617Species Pyrococcus furiosus [TaxId:2261] [189762] (2 PDB entries)
  8. 2831623Domain d3apgb1: 3apg B:2-471 [172297]
    Other proteins in same PDB: d3apga2, d3apgb2, d3apgc2, d3apgd2
    automated match to d1qvba_
    complexed with gol

Details for d3apgb1

PDB Entry: 3apg (more details), 2.35 Å

PDB Description: crystal structure of hyperthermophilic beta-glucosidase from pyrococcus furiosus
PDB Compounds: (B:) Beta-glucosidase

SCOPe Domain Sequences for d3apgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3apgb1 c.1.8.4 (B:2-471) automated matches {Pyrococcus furiosus [TaxId: 2261]}
kfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhly
kqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikeleki
anmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdrapagwldektv
vefvkfaafvayhlddlvdmwstmnepnvvynqgyinlrsgfppgylsfeaaekakfnli
qahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkldw
igvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllkyln
nayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaqg
frmrfglvyvdfetkkrylrpsalvfreiatqkeipeelahladlkfvtr

SCOPe Domain Coordinates for d3apgb1:

Click to download the PDB-style file with coordinates for d3apgb1.
(The format of our PDB-style files is described here.)

Timeline for d3apgb1: