SCOPe 2.05: Domain d3ap6d_: 3ap6 D:

Lineage for d3ap6d_ (3ap6 D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (48 PDB entries)

8. Domain d3ap6d_: 3ap6 D: [172291]
   automated match to d1a3ka_
   complexed with lat, so4

Details for d3ap6d_

PDB Entry: 3ap6, 1.58 Å

PDB Description: crystal structure of the galectin-8 n-terminal carbohydrate recognition domain in complex with lactose 3'-sulfate

PDB Compounds: (D:) Galectin-8

SCOPe Domain Sequences for d3ap6d_:

Sequence; same for both SEQRES and ATOM records:

>d3ap6d_ b.29.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpradvafhfn
prfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtllyg
hrigpekidtlgiygkvnihsigfsfs

Timeline for d3ap6d_:

• d3ap6d_ first appeared in SCOPe 2.01
  
• d3ap6d_ appears in SCOPe 2.04
  
• d3ap6d_ appears in SCOPe 2.06
  
• d3ap6d_ appears in the current release, SCOPe 2.08