SCOPe 2.04: Domain d3ap4d_: 3ap4 D:

Lineage for d3ap4d_ (3ap4 D:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (38 PDB entries)

8. Domain d3ap4d_: 3ap4 D: [172286]
   automated match to d1a3ka_
   complexed with lbt

Details for d3ap4d_

PDB Entry: 3ap4, 2.33 Å

PDB Description: crystal structure of the galectin-8 n-terminal carbohydrate recognition domain in complex with lactose

PDB Compounds: (D:) Galectin-8

SCOPe Domain Sequences for d3ap4d_:

Sequence; same for both SEQRES and ATOM records:

>d3ap4d_ b.29.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpradvafhfn
prfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtllyg
hrigpekidtlgiygkvnihsigfsfs

Timeline for d3ap4d_:

• d3ap4d_ first appeared in SCOPe 2.01
  
• d3ap4d_ appears in SCOPe 2.03
  
• d3ap4d_ appears in SCOPe 2.05
  
• d3ap4d_ appears in the current release, SCOPe 2.08