SCOPe 2.03: Domain d3ap4c_: 3ap4 C:

Lineage for d3ap4c_ (3ap4 C:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (29 PDB entries)

8. Domain d3ap4c_: 3ap4 C: [172285]
   automated match to d1a3ka_
   complexed with lbt

Details for d3ap4c_

PDB Entry: 3ap4, 2.33 Å

PDB Description: crystal structure of the galectin-8 n-terminal carbohydrate recognition domain in complex with lactose

PDB Compounds: (C:) Galectin-8

SCOPe Domain Sequences for d3ap4c_:

Sequence; same for both SEQRES and ATOM records:

>d3ap4c_ b.29.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpradvafhf
nprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtlly
ghrigpekidtlgiygkvnihsigfsf

Timeline for d3ap4c_:

• d3ap4c_ first appeared in SCOPe 2.01
  
• d3ap4c_ appears in SCOPe 2.02
  
• d3ap4c_ appears in SCOPe 2.04
  
• d3ap4c_ appears in the current release, SCOPe 2.08