SCOPe 2.06: Domain d4tnca_: 4tnc A:

Lineage for d4tnca_ (4tnc A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries)
   Uniprot P09860

8. Domain d4tnca_: 4tnc A: [17228]
   complexed with ca

Details for d4tnca_

PDB Entry: 4tnc, 2 Å

PDB Description: refined structure of chicken skeletal muscle troponin c in the two-calcium state at 2-angstroms resolution

PDB Compounds: (A:) troponin c

SCOPe Domain Sequences for d4tnca_:

Sequence; same for both SEQRES and ATOM records:

>d4tnca_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
amdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaii
eevdedgsgtidfeeflvmmvrqmkedakgkseeeladcfrifdknadgfidieelgeil
ratgehvteediedlmkdsdknndgridfdeflkmmegvq

Timeline for d4tnca_:

• d4tnca_ first appeared (with stable ids) in SCOP 1.55, called d4tnc__
  
• d4tnca_ appears in SCOPe 2.05
  
• d4tnca_ appears in SCOPe 2.07
  
• d4tnca_ appears in the current release, SCOPe 2.08