Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (7 species) includes rudiment esterase domain |
Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries) |
Domain d3al4k_: 3al4 K: [172230] Other proteins in same PDB: d3al4b_, d3al4d_, d3al4f_, d3al4h_, d3al4j_, d3al4l_ automated match to d1ruyh_ complexed with nag |
PDB Entry: 3al4 (more details), 2.87 Å
SCOPe Domain Sequences for d3al4k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3al4k_ b.19.1.2 (K:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti gkcpkyvkstklrlatglrni
Timeline for d3al4k_: