SCOPe 2.03: Domain d3al4k_: 3al4 K:

Lineage for d3al4k_ (3al4 K:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (6 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (86 PDB entries)

8. Domain d3al4k_: 3al4 K: [172230]
   automated match to d1ruyh_
   complexed with nag

Details for d3al4k_

PDB Entry: 3al4, 2.87 Å

PDB Description: crystal structure of the swine-origin a (h1n1)-2009 influenza a virus hemagglutinin (ha) reveals similar antigenicity to that of the 1918 pandemic virus

PDB Compounds: (K:) Hemagglutinin

SCOPe Domain Sequences for d3al4k_:

Sequence; same for both SEQRES and ATOM records:

>d3al4k_ b.19.1.2 (K:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrni

Timeline for d3al4k_:

• d3al4k_ first appeared in SCOPe 2.01
  
• d3al4k_ appears in SCOPe 2.02
  
• d3al4k_ appears in SCOPe 2.04
  
• d3al4k_ appears in the current release, SCOPe 2.08