Lineage for d1top__ (1top -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.5: Calmodulin-like [47502] (13 proteins) 
Protein Troponin C [47503] (5 species) Species Chicken (Gallus gallus) [TaxId:9031] [47504] (21 PDB entries) 
Domain d1top__: 1top - [17223]
Details for d1top__
PDB Entry: 1top (more details), 1.78 Å
PDB Description: structure of chicken skeletal muscle troponin-c at 1.78 angstroms resolution
SCOP Domain Sequences for d1top__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1top__ a.39.1.5 (-) Troponin C {Chicken (Gallus gallus)}
asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
iieevdedgsgtidfeeflvmmvrqmkedakgkseeelancfrifdknadgfidieelge
ilratgehvteediedlmkdsdknndgridfdeflkmmegvq
SCOP Domain Coordinates for d1top__:
Click to download the PDB-style file with coordinates for d1top__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1top__:
- d1top__ appears in SCOP 1.57
- d1top__ appears in the current release, SCOPe 2.08, called d1topa_
View in 3D