Lineage for d3ai3a_ (3ai3 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580725Species Gluconobacter frateurii [TaxId:38308] [189629] (3 PDB entries)
  8. 1580734Domain d3ai3a_: 3ai3 A: [172199]
    automated match to d1i01a_
    complexed with ndp, soe, sol

Details for d3ai3a_

PDB Entry: 3ai3 (more details), 1.8 Å

PDB Description: the crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with nadph and l-sorbose
PDB Compounds: (A:) NADPH-sorbose reductase

SCOPe Domain Sequences for d3ai3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ai3a_ c.2.1.0 (A:) automated matches {Gluconobacter frateurii [TaxId: 38308]}
mdmgisgkvavitgsssgiglaiaegfakegahivlvarqvdrlheaarslkekfgvrvl
evavdvatpegvdavvesvrssfggadilvnnagtgsnetimeaadekwqfywellvmaa
vrlarglvpgmrargggaiihnasicavqplwyepiynvtkaalmmfsktlatevikdni
rvncinpgliltpdwiktakeltkdnggdwkgylqsvadehapikrfaspeelanffvfl
cseratysvgsayfvdggmlktl

SCOPe Domain Coordinates for d3ai3a_:

Click to download the PDB-style file with coordinates for d3ai3a_.
(The format of our PDB-style files is described here.)

Timeline for d3ai3a_: