SCOPe 2.03: Domain d3ai1a_: 3ai1 A:

Lineage for d3ai1a_ (3ai1 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Gluconobacter frateurii [TaxId:38308] [189629] (3 PDB entries)

8. Domain d3ai1a_: 3ai1 A: [172189]
   automated match to d1i01a_

Details for d3ai1a_

PDB Entry: 3ai1, 2.38 Å

PDB Description: The crystal structure of L-sorbose reductase from Gluconobacter frateurii complexed with NADPH and L-sorbose reveals the structure bases of its catalytic mechanism and high substrate selectivity

PDB Compounds: (A:) NADPH-sorbose reductase

SCOPe Domain Sequences for d3ai1a_:

Sequence; same for both SEQRES and ATOM records:

>d3ai1a_ c.2.1.0 (A:) automated matches {Gluconobacter frateurii [TaxId: 38308]}
mdmgisgkvavitgsssgiglaiaegfakegahivlvarqvdrlheaarslkekfgvrvl
evavdvatpegvdavvesvrssfggadilvnnagtgsnetimeaadekwqfywelhvmaa
vrlarglvpgmrargggaiihnasicavqplwyepiynvtkaalmmfsktlatevikdni
rvncinpgliltpdwiktakeltkdnggdwkgylqsvadehapikrfaspeelanffvfl
cseratysvgsayfvdggmlktl

Timeline for d3ai1a_:

• d3ai1a_ first appeared in SCOPe 2.01
  
• d3ai1a_ appears in SCOPe 2.02
  
• d3ai1a_ appears in SCOPe 2.04
  
• d3ai1a_ appears in the current release, SCOPe 2.08