SCOPe 2.01: Domain d3ai0a_: 3ai0 A:

Lineage for d3ai0a_ (3ai0 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (16 species)
   not a true protein

7. Species Neotermes koshunensis [TaxId:60586] [189411] (2 PDB entries)

8. Domain d3ai0a_: 3ai0 A: [172188]
   automated match to d1wcga1
   complexed with gol, pnw

Details for d3ai0a_

PDB Entry: 3ai0, 1.4 Å

PDB Description: crystal structure of beta-glucosidase from termite neotermes koshunensis in complex with para-nitrophenyl-beta-d-glucopyranoside

PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d3ai0a_:

Sequence; same for both SEQRES and ATOM records:

>d3ai0a_ c.1.8.0 (A:) automated matches {Neotermes koshunensis [TaxId: 60586]}
tvytfpdefklgaatasyqiegawdengkgpniwdtlthehpdyvvdgatgdiaddsyhl
ykedvkilkelgaqvyrfsiswarvlpeghdnivnqdgidyynnlinellangiepmvtm
yhwdlpqalqdlggwpnlvlakysenyarvlfknfgdrvklwltfndpltfmdgyaseig
mapsintpgigdylaahtvihahariyhlydqefraeqggkvgislninwcepatnsaed
rascenyqqfnlglyahpifteegdypavlkdrvsrnsadegytdsrlpqftaeeveyir
gthdflginfytallgksgvegyepsryrdsgviltqdaawpisasswlkvvpwgfrkel
nwikneynnppvfitengfsdygglndtgrvhyytehlkemlkaihedgvnvigytawsl
mdnfewlrgysekfgiyavdfedparpripkesakvlaeimntrkiperfrd

Timeline for d3ai0a_:

• d3ai0a_ is new in SCOPe 2.01-stable
  
• d3ai0a_ appears in SCOPe 2.02
  
• d3ai0a_ appears in the current release, SCOPe 2.08