Lineage for d1bu3a_ (1bu3 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 768641Family a.39.1.4: Parvalbumin [47492] (2 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 768647Protein Parvalbumin [47495] (8 species)
  7. 768684Species Silver hake (Merluccius bilinearis) [TaxId:79698] [47500] (1 PDB entry)
  8. 768685Domain d1bu3a_: 1bu3 A: [17218]
    complexed with ace, ca, hoh

Details for d1bu3a_

PDB Entry: 1bu3 (more details), 1.65 Å

PDB Description: refined crystal structure of calcium-bound silver hake (pi 4.2) parvalbumin at 1.65 a.
PDB Compounds: (A:) calcium-binding protein

SCOP Domain Sequences for d1bu3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bu3a_ a.39.1.4 (A:) Parvalbumin {Silver hake (Merluccius bilinearis) [TaxId: 79698]}
afsgiladadvaaalkaceaadsfnykaffakvgltaksaddikkaffvidqdksgfiee
delklflqvfsagaraltdaetkaflkagdsdgdgaigvdewaalvka

SCOP Domain Coordinates for d1bu3a_:

Click to download the PDB-style file with coordinates for d1bu3a_.
(The format of our PDB-style files is described here.)

Timeline for d1bu3a_: