SCOP 1.73: Domain d1bu3a_: 1bu3 A:

Lineage for d1bu3a_ (1bu3 A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.4: Parvalbumin [47492] (2 proteins)
   6-helices; array of 3 hairpins, closed
   made with two-helical hairpin and two EF-hands

6. Protein Parvalbumin [47495] (7 species)

7. Species Silver hake (Merluccius bilinearis) [TaxId:79698] [47500] (1 PDB entry)

8. Domain d1bu3a_: 1bu3 A: [17218]
   complexed with ace, ca, hoh

Details for d1bu3a_

PDB Entry: 1bu3, 1.65 Å

PDB Description: refined crystal structure of calcium-bound silver hake (pi 4.2) parvalbumin at 1.65 a.

PDB Compounds: (A:) calcium-binding protein

SCOP Domain Sequences for d1bu3a_:

Sequence; same for both SEQRES and ATOM records:

>d1bu3a_ a.39.1.4 (A:) Parvalbumin {Silver hake (Merluccius bilinearis) [TaxId: 79698]}
afsgiladadvaaalkaceaadsfnykaffakvgltaksaddikkaffvidqdksgfiee
delklflqvfsagaraltdaetkaflkagdsdgdgaigvdewaalvka

Timeline for d1bu3a_:

• d1bu3a_ first appeared (with stable ids) in SCOP 1.55, called d1bu3__
  
• d1bu3a_ was called d1bu3__ in SCOP 1.71
  
• d1bu3a_ appears in SCOP 1.75
  
• d1bu3a_ appears in the current release, SCOPe 2.08