Lineage for d1bu3__ (1bu3 -)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97344Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 97345Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 97432Family a.39.1.4: Parvalbumin [47492] (2 proteins)
  6. 97437Protein Parvalbumin [47495] (6 species)
  7. 97465Species Silver hake (Merluccius bilinearis) [TaxId:79698] [47500] (1 PDB entry)
  8. 97466Domain d1bu3__: 1bu3 - [17218]

Details for d1bu3__

PDB Entry: 1bu3 (more details), 1.65 Å

PDB Description: refined crystal structure of calcium-bound silver hake (pi 4.2) parvalbumin at 1.65 a.

SCOP Domain Sequences for d1bu3__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bu3__ a.39.1.4 (-) Parvalbumin {Silver hake (Merluccius bilinearis)}
afsgiladadvaaalkaceaadsfnykaffakvgltaksaddikkaffvidqdksgfiee
delklflqvfsagaraltdaetkaflkagdsdgdgaigvdewaalvka

SCOP Domain Coordinates for d1bu3__:

Click to download the PDB-style file with coordinates for d1bu3__.
(The format of our PDB-style files is described here.)

Timeline for d1bu3__: