Lineage for d1a75a_ (1a75 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213166Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 213167Superfamily a.39.1: EF-hand [47473] (9 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 213286Family a.39.1.4: Parvalbumin [47492] (2 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 213291Protein Parvalbumin [47495] (6 species)
  7. 213321Species Whiting (Merlangius merlangus) [TaxId:8058] [47499] (1 PDB entry)
  8. 213322Domain d1a75a_: 1a75 A: [17216]

Details for d1a75a_

PDB Entry: 1a75 (more details), 1.9 Å

PDB Description: whiting parvalbumin

SCOP Domain Sequences for d1a75a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a75a_ a.39.1.4 (A:) Parvalbumin {Whiting (Merlangius merlangus)}
agiladadcaaavkaceaadsfsykaffakcglsgksaddikkafvfidqdksgfieede
lklflqvfkagaraltdaetkaflkagdsdgdgaigveewvalvka

SCOP Domain Coordinates for d1a75a_:

Click to download the PDB-style file with coordinates for d1a75a_.
(The format of our PDB-style files is described here.)

Timeline for d1a75a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a75b_