Lineage for d5pal__ (5pal -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.4: Parvalbumin [47492] (2 proteins) Protein Parvalbumin [47495] (6 species) 
Species Leopard shark (Triakis semifasciata) [TaxId:30493] [47498] (1 PDB entry) 
Domain d5pal__: 5pal - [17215]
Details for d5pal__
PDB Entry: 5pal (more details), 1.54 Å
PDB Description: crystal structure of the unique parvalbumin component from muscle of the leopard shark (triakis semifasciata). the first x-ray study of an alpha-parvalbumin
SCOP Domain Sequences for d5pal__:
Sequence; same for both SEQRES and ATOM records: (download)
>d5pal__ a.39.1.4 (-) Parvalbumin {Leopard shark (Triakis semifasciata)}
pmtkvlkaddinkaisafkdpgtfdykrffhlvglkgktdaqvkevfeildkdqsgfiee
eelkgvlkgfsahgrdlndtetkallaagdsdhdgkigadefakmvaqa
SCOP Domain Coordinates for d5pal__:
Click to download the PDB-style file with coordinates for d5pal__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5pal__:
- d5pal__ appears in SCOP 1.57
- d5pal__ appears in the current release, SCOPe 2.08, called d5pala_
View in 3D