Lineage for d3ag6a_ (3ag6 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2118898Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2119569Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2119570Protein automated matches [190459] (50 species)
    not a true protein
  7. 2119846Species Staphylococcus aureus [TaxId:93061] [189395] (2 PDB entries)
  8. 2119847Domain d3ag6a_: 3ag6 A: [172142]
    automated match to d1v8fa_
    complexed with acy, paj, pg4

Details for d3ag6a_

PDB Entry: 3ag6 (more details), 1.85 Å

PDB Description: Crystal Structure of Pantothenate Synthetase from Staphylococcus aureus in complex with pantoyl adenylate
PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d3ag6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag6a_ c.26.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 93061]}
mtklittvkemqhivkaakrsgttigfiptmgalhdghltmvresvstnditivsvfvnp
lqfgpnedfdayprqidkdlelvsevgadivfhpavedmypgelgidvkvgpladvlega
krpghfdgvvtvvnklfnivmpdyayfgkkdaqqlaiveqmvkdfnhaveiigidivrea
dglakssrnvylteqerqeavhlskslllaqalyqdgerqskviidrvteyleshiseri
eevavysypqlveqheitgrifislavkfskarlidniiigae

SCOPe Domain Coordinates for d3ag6a_:

Click to download the PDB-style file with coordinates for d3ag6a_.
(The format of our PDB-style files is described here.)

Timeline for d3ag6a_: