Lineage for d3ag4s_ (3ag4 S:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066160Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 1066318Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
    membrane-anchored rubredoxin-like domain
  6. 1066319Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 1066320Species Cow (Bos taurus) [TaxId:9913] [57820] (22 PDB entries)
  8. 1066338Domain d3ag4s_: 3ag4 S: [172132]
    Other proteins in same PDB: d3ag4a_, d3ag4c_, d3ag4d_, d3ag4e_, d3ag4g_, d3ag4h_, d3ag4i_, d3ag4j_, d3ag4k_, d3ag4l_, d3ag4m_, d3ag4n_, d3ag4p_, d3ag4q_, d3ag4r_, d3ag4t_, d3ag4u_, d3ag4v_, d3ag4w_, d3ag4x_, d3ag4y_, d3ag4z_
    automated match to d1occf_
    complexed with cdl, chd, cu, cua, cyn, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag4s_

PDB Entry: 3ag4 (more details), 2.05 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Cyanide Ion-bound Fully Reduced State at 100 K
PDB Compounds: (S:) Cytochrome c oxidase subunit 5B

SCOPe Domain Sequences for d3ag4s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag4s_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOPe Domain Coordinates for d3ag4s_:

Click to download the PDB-style file with coordinates for d3ag4s_.
(The format of our PDB-style files is described here.)

Timeline for d3ag4s_: