Lineage for d3ag4m_ (3ag4 M:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254048Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) (S)
    automatically mapped to Pfam PF02285
  5. 2254049Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)
  6. 2254087Protein automated matches [190273] (1 species)
    not a true protein
  7. 2254088Species Cow (Bos taurus) [TaxId:9913] [187065] (19 PDB entries)
  8. 2254101Domain d3ag4m_: 3ag4 M: [172127]
    Other proteins in same PDB: d3ag4a_, d3ag4b1, d3ag4b2, d3ag4c_, d3ag4d_, d3ag4e_, d3ag4f_, d3ag4g_, d3ag4h_, d3ag4i_, d3ag4j_, d3ag4k_, d3ag4l_, d3ag4n_, d3ag4o1, d3ag4o2, d3ag4p_, d3ag4q_, d3ag4r_, d3ag4s_, d3ag4t_, d3ag4u_, d3ag4v_, d3ag4w_, d3ag4x_, d3ag4y_
    automated match to d1occm_
    complexed with cdl, chd, cu, cua, cyn, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag4m_

PDB Entry: 3ag4 (more details), 2.05 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Cyanide Ion-bound Fully Reduced State at 100 K
PDB Compounds: (M:) Cytochrome c oxidase subunit 8B

SCOPe Domain Sequences for d3ag4m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag4m_ f.23.7.1 (M:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

SCOPe Domain Coordinates for d3ag4m_:

Click to download the PDB-style file with coordinates for d3ag4m_.
(The format of our PDB-style files is described here.)

Timeline for d3ag4m_: