SCOPe 2.07: Domain d3ag4k_: 3ag4 K:

Lineage for d3ag4k_ (3ag4 K:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family)
   automatically mapped to Pfam PF05392

5. Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)

6. Protein automated matches [190272] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187064] (25 PDB entries)

8. Domain d3ag4k_: 3ag4 K: [172125]
   Other proteins in same PDB: d3ag4a_, d3ag4b1, d3ag4b2, d3ag4c_, d3ag4d_, d3ag4e_, d3ag4f_, d3ag4g_, d3ag4h_, d3ag4i_, d3ag4j_, d3ag4l_, d3ag4m_, d3ag4n_, d3ag4o1, d3ag4o2, d3ag4p_, d3ag4q_, d3ag4r_, d3ag4s_, d3ag4t_, d3ag4u_, d3ag4v_, d3ag4w_, d3ag4y_, d3ag4z_
   automated match to d1occk_
   complexed with cdl, chd, cu, cua, cyn, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag4k_

PDB Entry: 3ag4, 2.05 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Cyanide Ion-bound Fully Reduced State at 100 K

PDB Compounds: (K:) Cytochrome c oxidase subunit 7B

SCOPe Domain Sequences for d3ag4k_:

Sequence; same for both SEQRES and ATOM records:

>d3ag4k_ f.23.5.1 (K:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

Timeline for d3ag4k_:

• d3ag4k_ first appeared in SCOPe 2.01
  
• d3ag4k_ appears in SCOPe 2.06
  
• d3ag4k_ appears in the current release, SCOPe 2.08