Lineage for d3ag4g_ (3ag4 G:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1957482Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
    automatically mapped to Pfam PF02046
  5. 1957483Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)
  6. 1957484Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 1957485Species Cow (Bos taurus) [TaxId:9913] [81408] (26 PDB entries)
  8. 1957502Domain d3ag4g_: 3ag4 G: [172121]
    Other proteins in same PDB: d3ag4a_, d3ag4b1, d3ag4b2, d3ag4c_, d3ag4d_, d3ag4e_, d3ag4f_, d3ag4h_, d3ag4i_, d3ag4j_, d3ag4k_, d3ag4l_, d3ag4m_, d3ag4n_, d3ag4o1, d3ag4o2, d3ag4p_, d3ag4q_, d3ag4r_, d3ag4s_, d3ag4u_, d3ag4v_, d3ag4w_, d3ag4x_, d3ag4y_, d3ag4z_
    automated match to d1occg_
    complexed with cdl, chd, cu, cua, cyn, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag4g_

PDB Entry: 3ag4 (more details), 2.05 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Cyanide Ion-bound Fully Reduced State at 100 K
PDB Compounds: (G:) Cytochrome c oxidase subunit 6A2

SCOPe Domain Sequences for d3ag4g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag4g_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOPe Domain Coordinates for d3ag4g_:

Click to download the PDB-style file with coordinates for d3ag4g_.
(The format of our PDB-style files is described here.)

Timeline for d3ag4g_: