Class g: Small proteins [56992] (90 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (3 families) |
Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein) membrane-anchored rubredoxin-like domain |
Protein Cytochrome c oxidase Subunit F [57819] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [57820] (22 PDB entries) |
Domain d3ag4f_: 3ag4 F: [172120] Other proteins in same PDB: d3ag4a_, d3ag4c_, d3ag4d_, d3ag4e_, d3ag4g_, d3ag4h_, d3ag4i_, d3ag4j_, d3ag4k_, d3ag4l_, d3ag4m_, d3ag4n_, d3ag4p_, d3ag4q_, d3ag4r_, d3ag4t_, d3ag4u_, d3ag4v_, d3ag4w_, d3ag4x_, d3ag4y_, d3ag4z_ automated match to d1occf_ complexed with cdl, chd, cu, cua, cyn, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3ag4 (more details), 2.05 Å
SCOPe Domain Sequences for d3ag4f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ag4f_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]} asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc iceednstviwfwlhkgeaqrcpscgthyklvphqlah
Timeline for d3ag4f_: