Lineage for d3ag4e_ (3ag4 E:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1095602Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1096546Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 1096547Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 1096548Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 1096549Species Cow (Bos taurus) [TaxId:9913] [48482] (23 PDB entries)
  8. 1096566Domain d3ag4e_: 3ag4 E: [172119]
    Other proteins in same PDB: d3ag4a_, d3ag4c_, d3ag4d_, d3ag4f_, d3ag4g_, d3ag4h_, d3ag4i_, d3ag4j_, d3ag4k_, d3ag4l_, d3ag4m_, d3ag4n_, d3ag4p_, d3ag4q_, d3ag4s_, d3ag4t_, d3ag4u_, d3ag4v_, d3ag4w_, d3ag4x_, d3ag4y_, d3ag4z_
    automated match to d1occe_
    complexed with cdl, chd, cu, cua, cyn, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag4e_

PDB Entry: 3ag4 (more details), 2.05 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Cyanide Ion-bound Fully Reduced State at 100 K
PDB Compounds: (E:) Cytochrome c oxidase subunit 5A

SCOPe Domain Sequences for d3ag4e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag4e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d3ag4e_:

Click to download the PDB-style file with coordinates for d3ag4e_.
(The format of our PDB-style files is described here.)

Timeline for d3ag4e_: