Lineage for d3ag3u_ (3ag3 U:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000510Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2000511Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 2000512Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2000550Protein automated matches [190271] (1 species)
    not a true protein
  7. 2000551Species Cow (Bos taurus) [TaxId:9913] [187063] (19 PDB entries)
  8. 2000553Domain d3ag3u_: 3ag3 U: [172110]
    Other proteins in same PDB: d3ag3a_, d3ag3b1, d3ag3b2, d3ag3c_, d3ag3d_, d3ag3e_, d3ag3f_, d3ag3g_, d3ag3i_, d3ag3j_, d3ag3k_, d3ag3l_, d3ag3m_, d3ag3n_, d3ag3o1, d3ag3o2, d3ag3p_, d3ag3q_, d3ag3r_, d3ag3s_, d3ag3t_, d3ag3v_, d3ag3w_, d3ag3x_, d3ag3y_, d3ag3z_
    automated match to d1ocrh_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn

Details for d3ag3u_

PDB Entry: 3ag3 (more details), 1.8 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Nitric Oxide-bound Fully Reduced State at 100 K
PDB Compounds: (U:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d3ag3u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag3u_ a.51.1.1 (U:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d3ag3u_:

Click to download the PDB-style file with coordinates for d3ag3u_.
(The format of our PDB-style files is described here.)

Timeline for d3ag3u_: