Lineage for d2pal__ (2pal -)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97344Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 97345Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 97432Family a.39.1.4: Parvalbumin [47492] (2 proteins)
  6. 97437Protein Parvalbumin [47495] (6 species)
  7. 97449Species Pike (Esox lucius) [TaxId:8010] [47497] (9 PDB entries)
  8. 97455Domain d2pal__: 2pal - [17211]

Details for d2pal__

PDB Entry: 2pal (more details), 1.8 Å

PDB Description: ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments

SCOP Domain Sequences for d2pal__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pal__ a.39.1.4 (-) Parvalbumin {Pike (Esox lucius)}
sfaglkdadvaaalaacsaadsfkhkeffakvglaskslddvkkafyvidqdksgfieed
elklflqnfspsaraltdaetkafladgdkdgdgmigvdefaamika

SCOP Domain Coordinates for d2pal__:

Click to download the PDB-style file with coordinates for d2pal__.
(The format of our PDB-style files is described here.)

Timeline for d2pal__: