| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) ![]() |
| Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (1 protein) |
| Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
| Species Cow (Bos taurus) [TaxId:9913] [81416] (23 PDB entries) |
| Domain d3ag3j_: 3ag3 J: [172100] Other proteins in same PDB: d3ag3a_, d3ag3c_, d3ag3d_, d3ag3e_, d3ag3f_, d3ag3g_, d3ag3h_, d3ag3i_, d3ag3k_, d3ag3l_, d3ag3m_, d3ag3n_, d3ag3p_, d3ag3q_, d3ag3r_, d3ag3s_, d3ag3t_, d3ag3u_, d3ag3v_, d3ag3x_, d3ag3y_, d3ag3z_ automated match to d1ocrj_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3ag3 (more details), 1.8 Å
SCOPe Domain Sequences for d3ag3j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ag3j_ f.23.4.1 (J:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk
Timeline for d3ag3j_: