SCOPe 2.06: Domain d3ag3i_: 3ag3 I:

Lineage for d3ag3i_ (3ag3 I:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family)
   automatically mapped to Pfam PF02937

5. Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81412] (37 PDB entries)

8. Domain d3ag3i_: 3ag3 I: [172099]
   Other proteins in same PDB: d3ag3a_, d3ag3b1, d3ag3b2, d3ag3c_, d3ag3d_, d3ag3e_, d3ag3f_, d3ag3g_, d3ag3h_, d3ag3j_, d3ag3k_, d3ag3l_, d3ag3m_, d3ag3n_, d3ag3o1, d3ag3o2, d3ag3p_, d3ag3q_, d3ag3r_, d3ag3s_, d3ag3t_, d3ag3u_, d3ag3w_, d3ag3x_, d3ag3y_, d3ag3z_
   automated match to d1occi_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn

Details for d3ag3i_

PDB Entry: 3ag3, 1.8 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Nitric Oxide-bound Fully Reduced State at 100 K

PDB Compounds: (I:) Cytochrome c oxidase subunit 6C

SCOPe Domain Sequences for d3ag3i_:

Sequence; same for both SEQRES and ATOM records:

>d3ag3i_ f.23.3.1 (I:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak

Timeline for d3ag3i_:

• d3ag3i_ first appeared in SCOPe 2.01
  
• d3ag3i_ appears in SCOPe 2.05
  
• d3ag3i_ appears in SCOPe 2.07
  
• d3ag3i_ appears in the current release, SCOPe 2.08