Lineage for d3ag3g_ (3ag3 G:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1059440Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
  5. 1059441Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)
  6. 1059442Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 1059443Species Cow (Bos taurus) [TaxId:9913] [81408] (22 PDB entries)
  8. 1059444Domain d3ag3g_: 3ag3 G: [172097]
    Other proteins in same PDB: d3ag3a_, d3ag3c_, d3ag3d_, d3ag3e_, d3ag3f_, d3ag3h_, d3ag3i_, d3ag3j_, d3ag3k_, d3ag3l_, d3ag3m_, d3ag3n_, d3ag3p_, d3ag3q_, d3ag3r_, d3ag3s_, d3ag3u_, d3ag3v_, d3ag3w_, d3ag3x_, d3ag3y_, d3ag3z_
    automated match to d1occg_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn

Details for d3ag3g_

PDB Entry: 3ag3 (more details), 1.8 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Nitric Oxide-bound Fully Reduced State at 100 K
PDB Compounds: (G:) Cytochrome c oxidase subunit 6A2

SCOPe Domain Sequences for d3ag3g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag3g_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOPe Domain Coordinates for d3ag3g_:

Click to download the PDB-style file with coordinates for d3ag3g_.
(The format of our PDB-style files is described here.)

Timeline for d3ag3g_: