Lineage for d3ag3e_ (3ag3 E:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1501801Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
    automatically mapped to Pfam PF02284
  5. 1501802Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 1501803Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 1501804Species Cow (Bos taurus) [TaxId:9913] [48482] (25 PDB entries)
  8. 1501805Domain d3ag3e_: 3ag3 E: [172095]
    Other proteins in same PDB: d3ag3a_, d3ag3b1, d3ag3b2, d3ag3c_, d3ag3d_, d3ag3f_, d3ag3g_, d3ag3h_, d3ag3i_, d3ag3j_, d3ag3k_, d3ag3l_, d3ag3m_, d3ag3n_, d3ag3o1, d3ag3o2, d3ag3p_, d3ag3q_, d3ag3s_, d3ag3t_, d3ag3u_, d3ag3v_, d3ag3w_, d3ag3x_, d3ag3y_, d3ag3z_
    automated match to d1occe_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn

Details for d3ag3e_

PDB Entry: 3ag3 (more details), 1.8 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Nitric Oxide-bound Fully Reduced State at 100 K
PDB Compounds: (E:) Cytochrome c oxidase subunit 5A

SCOPe Domain Sequences for d3ag3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag3e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d3ag3e_:

Click to download the PDB-style file with coordinates for d3ag3e_.
(The format of our PDB-style files is described here.)

Timeline for d3ag3e_: