SCOPe 2.01: Domain d3ag3e_: 3ag3 E:

Lineage for d3ag3e_ (3ag3 E:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family)

5. Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)

6. Protein Cytochrome c oxidase subunit E [48481] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48482] (22 PDB entries)

8. Domain d3ag3e_: 3ag3 E: [172095]
   Other proteins in same PDB: d3ag3a_, d3ag3c_, d3ag3d_, d3ag3f_, d3ag3g_, d3ag3h_, d3ag3i_, d3ag3j_, d3ag3k_, d3ag3l_, d3ag3m_, d3ag3n_, d3ag3p_, d3ag3q_, d3ag3s_, d3ag3t_, d3ag3u_, d3ag3v_, d3ag3w_, d3ag3x_, d3ag3y_, d3ag3z_
   automated match to d1occe_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn

Details for d3ag3e_

PDB Entry: 3ag3, 1.8 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Nitric Oxide-bound Fully Reduced State at 100 K

PDB Compounds: (E:) Cytochrome c oxidase subunit 5A

SCOPe Domain Sequences for d3ag3e_:

Sequence; same for both SEQRES and ATOM records:

>d3ag3e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

Timeline for d3ag3e_:

• d3ag3e_ is new in SCOPe 2.01-stable
  
• d3ag3e_ appears in SCOPe 2.02
  
• d3ag3e_ appears in the current release, SCOPe 2.08