SCOP 1.63: Domain d1pal__: 1pal -

Lineage for d1pal__ (1pal -)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (9 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.4: Parvalbumin [47492] (2 proteins)
   6-helices; array of 3 hairpins, closed
   made with two-helical hairpin and two EF-hands

6. Protein Parvalbumin [47495] (6 species)

7. Species Pike (Esox lucius) [TaxId:8010] [47497] (9 PDB entries)

8. Domain d1pal__: 1pal - [17209]
   complexed with ca, nh4

Details for d1pal__

PDB Entry: 1pal, 1.65 Å

PDB Description: ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments

SCOP Domain Sequences for d1pal__:

Sequence; same for both SEQRES and ATOM records:

>d1pal__ a.39.1.4 (-) Parvalbumin {Pike (Esox lucius)}
sfaglkdadvaaalaacsaadsfkhkeffakvglaskslddvkkafyvidqdksgfieed
elklflqnfspsaraltdaetkafladgdkdgdgmigvdefaamika

Timeline for d1pal__:

• d1pal__ first appeared (with stable ids) in SCOP 1.55
  
• d1pal__ appears in SCOP 1.61
  
• d1pal__ appears in SCOP 1.65
  
• d1pal__ appears in the current release, SCOPe 2.08, called d1pala_