Lineage for d3ag2x_ (3ag2 X:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456646Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1456857Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
    automatically mapped to Pfam PF05392
  5. 1456858Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)
  6. 1456876Protein automated matches [190272] (1 species)
    not a true protein
  7. 1456877Species Cow (Bos taurus) [TaxId:9913] [187064] (16 PDB entries)
  8. 1456883Domain d3ag2x_: 3ag2 X: [172089]
    Other proteins in same PDB: d3ag2a_, d3ag2b1, d3ag2b2, d3ag2c_, d3ag2d_, d3ag2e_, d3ag2f_, d3ag2g_, d3ag2h_, d3ag2i_, d3ag2j_, d3ag2l_, d3ag2m_, d3ag2n_, d3ag2o1, d3ag2o2, d3ag2p_, d3ag2q_, d3ag2r_, d3ag2s_, d3ag2t_, d3ag2u_, d3ag2v_, d3ag2w_, d3ag2y_, d3ag2z_
    automated match to d1occk_
    complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag2x_

PDB Entry: 3ag2 (more details), 1.8 Å

PDB Description: bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 100 k
PDB Compounds: (X:) Cytochrome c oxidase subunit 7B

SCOPe Domain Sequences for d3ag2x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag2x_ f.23.5.1 (X:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOPe Domain Coordinates for d3ag2x_:

Click to download the PDB-style file with coordinates for d3ag2x_.
(The format of our PDB-style files is described here.)

Timeline for d3ag2x_: