Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) |
Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins) |
Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species) probably responsible for the dimerization of the mitochondrial cytochrome c oxidase |
Species Cow (Bos taurus) [TaxId:9913] [81408] (22 PDB entries) |
Domain d3ag2t_: 3ag2 T: [172085] Other proteins in same PDB: d3ag2a_, d3ag2c_, d3ag2d_, d3ag2e_, d3ag2f_, d3ag2h_, d3ag2i_, d3ag2j_, d3ag2k_, d3ag2l_, d3ag2m_, d3ag2n_, d3ag2p_, d3ag2q_, d3ag2r_, d3ag2s_, d3ag2u_, d3ag2v_, d3ag2w_, d3ag2x_, d3ag2y_, d3ag2z_ automated match to d1occg_ complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3ag2 (more details), 1.8 Å
SCOPe Domain Sequences for d3ag2t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ag2t_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]} asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf swgdgnhtffhnprvnplptgyek
Timeline for d3ag2t_: