SCOPe 2.01: Domain d3ag2r_: 3ag2 R:

Lineage for d3ag2r_ (3ag2 R:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family)

5. Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)

6. Protein Cytochrome c oxidase subunit E [48481] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48482] (22 PDB entries)

8. Domain d3ag2r_: 3ag2 R: [172083]
   Other proteins in same PDB: d3ag2a_, d3ag2c_, d3ag2d_, d3ag2f_, d3ag2g_, d3ag2h_, d3ag2i_, d3ag2j_, d3ag2k_, d3ag2l_, d3ag2m_, d3ag2n_, d3ag2p_, d3ag2q_, d3ag2s_, d3ag2t_, d3ag2u_, d3ag2v_, d3ag2w_, d3ag2x_, d3ag2y_, d3ag2z_
   automated match to d1occe_
   complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag2r_

PDB Entry: 3ag2, 1.8 Å

PDB Description: bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 100 k

PDB Compounds: (R:) Cytochrome c oxidase subunit 5A

SCOPe Domain Sequences for d3ag2r_:

Sequence; same for both SEQRES and ATOM records:

>d3ag2r_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

Timeline for d3ag2r_:

• d3ag2r_ is new in SCOPe 2.01-stable
  
• d3ag2r_ appears in SCOPe 2.02
  
• d3ag2r_ appears in the current release, SCOPe 2.08