SCOPe 2.02: Domain d3ag2j_: 3ag2 J:

Lineage for d3ag2j_ (3ag2 J:)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family)

5. Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81416] (23 PDB entries)

8. Domain d3ag2j_: 3ag2 J: [172076]
   Other proteins in same PDB: d3ag2a_, d3ag2c_, d3ag2d_, d3ag2e_, d3ag2f_, d3ag2g_, d3ag2h_, d3ag2i_, d3ag2k_, d3ag2l_, d3ag2m_, d3ag2n_, d3ag2p_, d3ag2q_, d3ag2r_, d3ag2s_, d3ag2t_, d3ag2u_, d3ag2v_, d3ag2x_, d3ag2y_, d3ag2z_
   automated match to d1ocrj_
   complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag2j_

PDB Entry: 3ag2, 1.8 Å

PDB Description: bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 100 k

PDB Compounds: (J:) Cytochrome c oxidase polypeptide 7A1

SCOPe Domain Sequences for d3ag2j_:

Sequence; same for both SEQRES and ATOM records:

>d3ag2j_ f.23.4.1 (J:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk

Timeline for d3ag2j_:

• d3ag2j_ first appeared in SCOPe 2.01
  
• d3ag2j_ appears in SCOPe 2.03
  
• d3ag2j_ appears in the current release, SCOPe 2.08