![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
![]() | Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein) membrane-anchored rubredoxin-like domain automatically mapped to Pfam PF01215 |
![]() | Protein Cytochrome c oxidase Subunit F [57819] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [57820] (23 PDB entries) |
![]() | Domain d3ag2f_: 3ag2 F: [172072] Other proteins in same PDB: d3ag2a_, d3ag2b1, d3ag2b2, d3ag2c_, d3ag2d_, d3ag2e_, d3ag2g_, d3ag2h_, d3ag2i_, d3ag2j_, d3ag2k_, d3ag2l_, d3ag2m_, d3ag2n_, d3ag2o1, d3ag2o2, d3ag2p_, d3ag2q_, d3ag2r_, d3ag2t_, d3ag2u_, d3ag2v_, d3ag2w_, d3ag2x_, d3ag2y_, d3ag2z_ automated match to d1occf_ complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3ag2 (more details), 1.8 Å
SCOPe Domain Sequences for d3ag2f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ag2f_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]} asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc iceednstviwfwlhkgeaqrcpscgthyklvphqlah
Timeline for d3ag2f_:
![]() Domains from other chains: (mouse over for more information) d3ag2a_, d3ag2b1, d3ag2b2, d3ag2c_, d3ag2d_, d3ag2e_, d3ag2g_, d3ag2h_, d3ag2i_, d3ag2j_, d3ag2k_, d3ag2l_, d3ag2m_, d3ag2n_, d3ag2o1, d3ag2o2, d3ag2p_, d3ag2q_, d3ag2r_, d3ag2s_, d3ag2t_, d3ag2u_, d3ag2v_, d3ag2w_, d3ag2x_, d3ag2y_, d3ag2z_ |