Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) automatically mapped to Pfam PF00510 |
Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81444] (37 PDB entries) |
Domain d3ag2c_: 3ag2 C: [172069] Other proteins in same PDB: d3ag2a_, d3ag2b1, d3ag2b2, d3ag2d_, d3ag2e_, d3ag2f_, d3ag2g_, d3ag2h_, d3ag2i_, d3ag2j_, d3ag2k_, d3ag2l_, d3ag2m_, d3ag2n_, d3ag2o1, d3ag2o2, d3ag2q_, d3ag2r_, d3ag2s_, d3ag2t_, d3ag2u_, d3ag2v_, d3ag2w_, d3ag2x_, d3ag2y_, d3ag2z_ automated match to d1occc_ complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3ag2 (more details), 1.8 Å
SCOPe Domain Sequences for d3ag2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ag2c_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw hfvdvvwlflyvsiywwgs
Timeline for d3ag2c_:
View in 3D Domains from other chains: (mouse over for more information) d3ag2a_, d3ag2b1, d3ag2b2, d3ag2d_, d3ag2e_, d3ag2f_, d3ag2g_, d3ag2h_, d3ag2i_, d3ag2j_, d3ag2k_, d3ag2l_, d3ag2m_, d3ag2n_, d3ag2o1, d3ag2o2, d3ag2p_, d3ag2q_, d3ag2r_, d3ag2s_, d3ag2t_, d3ag2u_, d3ag2v_, d3ag2w_, d3ag2x_, d3ag2y_, d3ag2z_ |