Lineage for d3ag1x_ (3ag1 X:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1059590Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
  5. 1059591Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)
  6. 1059608Protein automated matches [190272] (1 species)
    not a true protein
  7. 1059609Species Cow (Bos taurus) [TaxId:9913] [187064] (15 PDB entries)
  8. 1059629Domain d3ag1x_: 3ag1 X: [172065]
    Other proteins in same PDB: d3ag1a_, d3ag1c_, d3ag1d_, d3ag1e_, d3ag1f_, d3ag1g_, d3ag1h_, d3ag1i_, d3ag1j_, d3ag1l_, d3ag1m_, d3ag1n_, d3ag1p_, d3ag1q_, d3ag1r_, d3ag1s_, d3ag1t_, d3ag1u_, d3ag1v_, d3ag1w_, d3ag1y_, d3ag1z_
    automated match to d1occk_
    complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag1x_

PDB Entry: 3ag1 (more details), 2.2 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Carbon Monoxide-bound Fully Reduced State at 280 K
PDB Compounds: (X:) Cytochrome c oxidase subunit 7B

SCOPe Domain Sequences for d3ag1x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag1x_ f.23.5.1 (X:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOPe Domain Coordinates for d3ag1x_:

Click to download the PDB-style file with coordinates for d3ag1x_.
(The format of our PDB-style files is described here.)

Timeline for d3ag1x_: